SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5GGM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5GGM0
Domain Number 1 Region: 97-232
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.45e-17
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00044
Further Details:      
 
Domain Number 2 Region: 408-413,467-577
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000144
Family Pseudo ankyrin repeat 0.043
Further Details:      
 
Weak hits

Sequence:  C5GGM0
Domain Number - Region: 564-620
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00183
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5GGM0
Sequence length 662
Comment (tr|C5GGM0|C5GGM0_AJEDR) Uncharacterized protein {ECO:0000313|EMBL:EEQ88265.1} KW=Complete proteome; Reference proteome OX=559297 OS=dermatitidis). GN=BDCG_03385 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MAVDFTPPHTLSPQGSKAQVPRDKVTAIPGVALVNRGTGTEIRSHSHVYGNKKGTVVGEH
GVELDRNNWLSASNLSCNKNPRQNVLISTNASFAEIAIPFLKKISDVEIRVISEDVLDFA
QGTCYLNTPISAQPGSKLSSLPWLDSTATELIEWADVLIVNPIDAGTLGAMVAGLTTSLT
LTVLRGWDITKTVLLVPRMTTSEWQSPITKRQLSDLATFWPWVKVLPPTLSKFEIPIGLV
EIPWDGWTAFRREIGKCLAPSFLSSTMQEDDKLANDVASGIVSTPLAISNNLHEKREQVT
NNETYQNGINKVLTSAIRKEKPILPPELLTMIFEMLDDWETAMSVGVYAKIPVPEKWRPC
IPSPGSPATFEYIVLRGSIKEIEQQLSAIPPRKPLSRIVTDLILKFSRTDILDTICKSRM
DLYLATPQLRNLPLSASSRFGSTSILTWWQNCSTLPALPIKDYLPEAIDAASRAGFVNVL
EWWRQSGRPFRYTERSLESASAEGQIAILDWWKNVSKSAPPSDPIPLKVGKSVLLAAQSG
RTDSLAWWDKSDIPFSHAESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGH
VEVLEWWKRSGLPVEFKTCDIEEALEDAVSGAEQRVRRWWARNGLNLGVGTNEWMMVKTL
NS
Download sequence
Identical sequences A0A179UF15 C5GGM0 F2T290 T5BUM5
BDBG_02183T0 BDCG_03385T0 XP_002627512.1.14838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]