SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5IJY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C5IJY8
Domain Number - Region: 435-481
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000955
Family Pseudo ankyrin repeat 0.056
Further Details:      
 
Domain Number - Region: 290-342
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00824
Family DRTGG domain 0.034
Further Details:      
 
Domain Number - Region: 133-188
Classification Level Classification E-value
Superfamily MCP/YpsA-like 0.0168
Family MoCo carrier protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5IJY8
Sequence length 1087
Comment (tr|C5IJY8|C5IJY8_XENLA) Transient receptor potential cation channel subfamily M member 8b {ECO:0000313|EMBL:ACR44149.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=TRPM8b OC=Xenopus.
Sequence
MTCQYDLEGSQKLYSSIELSPAEQLSGNVERYSIIKDIKKRECVVFTKDSSSQESLCKCG
YLKRQHTEGVQTNQNDKWNYKRHTKEVSTDAYGEIQFETFGRRAKYIRLSRDTTPEILYK
LMTSYWQLRTPNLIISVTGGARNFSLKPRIRKIIRRLVYIAQSKGAWIFTGGTHHGLMKY
IGEVVRDNTISRSSEGKVVAIGIAAWGMISNRDSLIRSPDAEGNYIAHYDMDGQKEDGLY
FLDNNHTHFILVDNGSHKHPTIEAGLRASLEKCISELTAPDSDYSGKIPIVCFAHSGGKE
TLKAINRALKSNIPCIVVEGSGQIADVIASLVEAEGTPVTSTVIKEKMLQFLKYSVSCLT
ENELEAWIQWVKEIMESPHLLTVITIDEAGDETVSNAISSALYKAYSTSKQDKGNWNAQL
KLLLDWNQLELASNELFANGQRWKTADLEDAMFSAIVKDRPEFVRLLLENGLDLDNFASS
EILRQLFSEHFSTHAFKSLEVADKSYSPLLTFVWRIVLFYQPSNKEKCNSSDYKIQNISS
LIKRHPTHILFLWAILQNKKELSTVIWEQAKGCTLAALGASKLLKHLAKGNKDASAAQES
EEMANDYETRAIELFTECYSNDKKIAEMVLVHPCEAWGKSNCLEMAVGANDQRFIAQPGV
QNFISKQWYGWISRDTKTWKILLSLFFFPLISCGFITFRKDSNRKKGHLWKYFLFFTSPF
AVFSWTVIFYIGFLFLFAYVLLMDFQPIPTGLEIVVYLLVFILLCTEIRQMTIGKAKYSR
DRWNIMDCMAILYFIVGVLFRLQNSSPSALYIGRVILCLDYIIFTLRLIHIFTISQNLGP
KIIMLQRMFVDVFFFLFLFAVWIVAFGVAHQGILRLNEHRWEWIFRSVIYQPYLAMFGEP
FSDVDATYDFDKCTITGNESKPMCVEMDSENNPRFPEWITIPLVCVYMLSTNILLVNLLI
AMFGYTVGSVQDNNEQVWKFQRYFLVQEYCNQLTIPFPFVIFGYIYVIIRNMINCCSKKH
EPPSSPCCSNAEHNKTLAWEAVMKENYLVKKTSEAQNNMEMEHRFKQLEGKLNDLQSLVM
NLTVKIK
Download sequence
Identical sequences C5IJY8
NP_001155067.1.7800 gi|238534453|gb|ACR44149| gi|239049985|ref|NP_001155067|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]