SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5IL70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5IL70
Domain Number 1 Region: 43-254
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 5.49e-116
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000366
Further Details:      
 
Domain Number 2 Region: 2-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.49e-17
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5IL70
Sequence length 254
Comment (tr|C5IL70|C5IL70_9EURY) Methyl coenzyme reductase subunit A {ECO:0000313|EMBL:ACR61598.1} OX=114243 OS=uncultured euryarchaeote. GN=mcrA OC=Archaea; Euryarchaeota; environmental samples.
Sequence
RMQIGMSFIGAYKMCAGEAAVADLAFTAKHAGMVEMATILPARRARGPNEPGGIKFGHFA
DMIQSDRKYPNDPVRSSLEIVAGGCMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDDYT
SYGVDYVKKKYGDLSKVKATQETVNDIASEVTLYGMEQYEEFPTALESHFGGSQRATVLA
AASGVTTSLATANSNAGLNAWYMSMLLHKEGWSRLGFYGYDLQDQCGSANTLSIRPDEGC
IGELRGPNYPNYAM
Download sequence
Identical sequences C5IL70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]