SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5J5M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C5J5M3
Domain Number - Region: 9-61
Classification Level Classification E-value
Superfamily TM1646-like 0.0235
Family TM1646-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5J5M3
Sequence length 89
Comment (tr|C5J5M3|C5J5M3_MYCCR) Uncharacterized protein {ECO:0000313|EMBL:CAT04746.1} KW=Complete proteome; Reference proteome OX=572263 OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147). GN=MCJ_000710 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MDSIDDIKSFENLKEITKNIPNFRELVNETIKEVKENPEFKNSPYYKKIKIILEKLDEKT
PDFDLKKAIESEKLFEKISMLDKIMPNAG
Download sequence
Identical sequences C5J5M3
gi|240047200|ref|YP_002960588.1| 45361.MCJ_000710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]