SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5PH33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5PH33
Domain Number 1 Region: 90-240
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.22e-19
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00036
Further Details:      
 
Domain Number 2 Region: 402-412,463-574
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000824
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Weak hits

Sequence:  C5PH33
Domain Number - Region: 559-616
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000745
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5PH33
Sequence length 656
Comment (tr|C5PH33|C5PH33_COCP7) Uncharacterized protein {ECO:0000313|EMBL:EER23836.1} KW=Complete proteome OX=222929 OS=Coccidioides posadasii (strain C735) (Valley fever fungus). GN=CPC735_052060 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MAVDSKLRSDSHYFGAHDPQTQPTGVPAAMSSGSETGDMSNIGAGDNSGLPEMKQPVAHA
SGTMNVGQMRLLNSPSRHHNRILLSTNTPFSDTVMRSLLRDPDIELRLIADKDFNDGADG
VDNLLYYPDIPQSETYRSRREWMNITAASLADWADVLIVAPVDAGTLGSMVSGLTTSLTL
TILRGWDISKTILLVPKMMLLEWKSPITGRQLDQIRTFWPWVKILPPVLSRFEPPDSLVE
VPWEGREMFYEEVRKGLGWPFNVNGAEDKIDSLDEAVIGGRMDKHLVKNDMDTATVLENR
SESTVRRSSTPSRDPNAPVLPPELLTMIFEALGDWETSTAVGVYARIPMPEHWKAFAPKA
DCPSTNFSLEYTILRSPLCDITKLLSSAPPWKPLSNLAAHLIFKFCRTDVLDYICQSRID
LYWSTPRLSSLPLRASAVYGNTTLLEWWRNCPDLPTNDYLPDALDGASRAGFIHVLEWWR
KSGLPLRYTERALESASAEGQITVLDWWKRISESSAYSDPVPLKIGKSVLLAAQSGKTAS
LAWWDRSGIPYSHGESVARIASTHGHVPVLELWYRRKGSKIIFDNQVLVGATKNGHVDVL
EWWRRSGLRVEFKTCDIEEALEDAVSGAEDRVRRWWERNGLNLGVGTSEWMKVKVL
Download sequence
Identical sequences C5PH33
XP_003065981.1.1890 222929.C5PH33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]