SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5XUZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C5XUZ8
Domain Number - Region: 323-340,374-446
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0129
Family Pseudo ankyrin repeat 0.059
Further Details:      
 
Domain Number - Region: 225-258,478-608
Classification Level Classification E-value
Superfamily TPR-like 0.0484
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5XUZ8
Sequence length 729
Comment (tr|C5XUZ8|C5XUZ8_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EES06997.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3004G183100 OC=Sorghum.
Sequence
MATSSAPRLPKPALRAASSSSLHTPNPRSRRQRATSEQHDQHVDSKWRRQPRAPPRRGEG
PKRRLRSLIQREEIDDALALVDSIASGGGSGKCLPLPVVPCNILIKRLCSGGRVADAERV
FATLGASATVVTYNTMVNGYCRAGRIEDARRLISGMPFPPDTFTFNPLIRALCVRGRVPD
ALAVFDDMLHRGCSPSVVTYSILLDATCKASGYRQAMVLLDEMRAKGCEPDIVTYNVLIN
AMCNEGDVDEALNILSDLPSHGCKPDAVTYTPVLKSLCGSERWKEVEELFAEMASNKCAP
DEVTFNTIVTSLCQQGLVDRAIKVVDHMSEHGCIPDIVTYSSILDGLCDVGRVDDAVELL
SRLKSYGCKPDTIAYTTVLKGLCSIEQWEHAEELMAEMVCSDCPPDEVTFNTVIASLCQK
GLVDRAIKVVEQMSENGCNPDIVTYNSIIDGLCNERCIDDAMELLSNLQSYGCKPDIVTF
NTLLKGLCSVDRWEDAEQLMVNMMHSDCPPDATTFNTVITSLCQKGLLLQAIETLKIMAE
NGCIPNQSTYNIVVDALLKAGKTQEALKLLSGMTNGTPDLITYNTVISNITKAGKMEEAL
DLLRVMVSNGLSPDTITYRSLAYGICREDGTDRAIRMLCRLQDMGLSPDATFYNDILLGF
CQNWRTDIAIDCFAHMVSSGCMPDESTYIILLEALAYECLLDEAKQLLVNLCSLGVLDKS
LIEEESHYS
Download sequence
Identical sequences C5XUZ8
jgi|Sorbi1|5038476|Sb04g023230 4558.Sb04g023230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]