SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6CRH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6CRH8
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily TM1646-like 7.19e-33
Family TM1646-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C6CRH8
Sequence length 147
Comment (tr|C6CRH8|C6CRH8_PAESJ) Uncharacterized protein {ECO:0000313|EMBL:ACS98695.1} KW=Complete proteome; Reference proteome OX=324057 OS=Paenibacillus sp. (strain JDR-2). GN=Pjdr2_0015 OC=Paenibacillus.
Sequence
MKIDQSWRPLGQNRAGGDTATKPAPARSFSDALVQQDALRTQEQLQQKLTEIHNQGERLA
RTMTVRELKMYRQMVKRFLEDTVKRGIGLKELRGFDRRGRTKRYKLLDEIDSALVSMAEE
LLETEQGRIELLGRIGEIRGLLINLLF
Download sequence
Identical sequences C6CRH8
WP_012772017.1.29859 324057.Pjdr2_0015 gi|251794051|ref|YP_003008782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]