SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6HDG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6HDG6
Domain Number 1 Region: 82-237
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000000000126
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0005
Further Details:      
 
Domain Number 2 Region: 398-410,464-596
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000379
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6HDG6
Sequence length 659
Comment (tr|C6HDG6|C6HDG6_AJECH) Uncharacterized protein {ECO:0000313|EMBL:EER41600.1} KW=Complete proteome; Reference proteome OX=544712 OS=(Histoplasma capsulatum). GN=HCDG_04247 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MAVDFTLPHALSPQYSQHQAPRDKVTAMPGVALTNGCTGIEIGADTRVYENKNGATVSEV
EVELNNNNGMSSADPPCNKNARKHVLLSTNASFAKVAIPFLLKMADVELRVISDDALDFA
QGACYPDTPISAQPGSKLSTPPWMNVTAAELIDWADVLVLGSLGAGTLGAMIAGLTTSLT
LTILRGWDISKRVFLVPGMTTSEWQFPMTKRQLSNLATFWPLIKVLPPTLSKFEHPAGLV
EIPWDGWTVFSSEVRNACSSLPGPMQEDNKLANNACSGTRSTPLVISSHLHERQQETNEE
PNQLGTKSQSTNAICKERPILPPELLTMIFEMLGDWETATSVGVYAKIPVPEQWKPYIPT
ARLPATFEYIVLRGSIKEIEEQLSTIPPRRPLSRIATDLILKFSRTDILDTLCRLRMDLY
LSTPDLKNLPLSASSKFGSTSLLTWWHKSSILPTLPIKDYLPEAIDAASRAGFVDVLEWW
RQSGLPFRYTERSLESASAEGQIAVLDWWKTVSKNAPLGNPVPLKVGKSVLLAAQSGRTD
SLAWWDKSDIPFSHSESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGHVEV
LEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWAQNGLNLGVGTNEWMMVKTLNT
Download sequence
Identical sequences C6HDG6 F0UU90
HCDG_04247T0 HCEG_08682T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]