SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6JVX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6JVX0
Domain Number 1 Region: 85-200
Classification Level Classification E-value
Superfamily ISP domain 3.87e-37
Family Rieske iron-sulfur protein (ISP) 0.00000288
Further Details:      
 
Domain Number 2 Region: 16-84
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.68e-20
Family ISP transmembrane anchor 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6JVX0
Sequence length 201
Comment (tr|C6JVX0|C6JVX0_TIGCA) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} OX=6832 OS=Tigriopus californicus (Marine copepod). GN=RISP OC=Copepoda; Harpacticoida; Harpacticidae; Tigriopus.
Sequence
VLGQKAVPVCSQIRLAHTDMEVPDFTYYRRSSTKDSTAKNRESHANRNGFAYLMTAGAAI
PSVYGATKFVNVFISNLSPSRDVLAMAKIEVKLSDIPEGKNMTFKWRGKPLFVRHRTSAE
IDTENKVDATSLRDPQTDEERVKDPKFLIVIGVCTHLGCVPIANAGQFGGYYCPCHGSHY
DASGRIRKGPAPLNLEVPEYE
Download sequence
Identical sequences C6JVX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]