SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6T1S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6T1S9
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.26e-27
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6T1S9
Sequence length 120
Comment (tr|C6T1S9|C6T1S9_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:ACU15540.1} OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN= OC=Phaseoleae; Glycine; Soja.
Sequence
MVLLQLDPFLNELTSMFERSTKLGSVWVTLKRSSLKSKVQRNKLAAAGEAVEFRCLIRAT
DGKKTISTSVGPKDHQRFQASYATILKAHMTALKKRERKDKKKPAEADKREGSSKRLKKS
Download sequence
Identical sequences C6T1S9
NP_001238334.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]