SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6ZB08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6ZB08
Domain Number - Region: 76-95
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00667
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6ZB08
Sequence length 111
Comment (tr|C6ZB08|C6ZB08_9BACE) Uncharacterized protein {ECO:0000313|EMBL:EET18067.1} KW=Complete proteome OX=457394 OS=Bacteroides sp. 4_3_47FAA. GN=BSFG_04216 OC=Bacteroides.
Sequence
MNDIPPDSLALTGEQKNDVRRMASLGYAPEDIAAYLGLDASECFLFVYDAGIPGTTIRGL
IREGVLVSRAAPEIKLHEAAEDGNIDAVKLLTEIQERRLFENLLKDMDEYE
Download sequence
Identical sequences A0A174L0D6 C6ZB08 I8WC77
WP_007848421.1.36284 WP_007848421.1.54640 WP_007848421.1.8648 WP_007848421.1.97168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]