SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7QGD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7QGD2
Domain Number 1 Region: 53-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.94e-36
Family Glycosyl hydrolases family 16 0.013
Further Details:      
 
Domain Number 2 Region: 553-677
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.63e-33
Family Galactose-binding domain 0.027
Further Details:      
 
Domain Number 3 Region: 689-814
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-32
Family Galactose-binding domain 0.017
Further Details:      
 
Domain Number 4 Region: 332-447
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.59e-27
Family Ricin B-like 0.0013
Further Details:      
 
Domain Number 5 Region: 457-543
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000001
Family Cadherin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7QGD2
Sequence length 815
Comment (tr|C7QGD2|C7QGD2_CATAD) Coagulation factor 5/8 type domain protein {ECO:0000313|EMBL:ACU72977.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_4113 OC=Catenulispora.
Sequence
MLFTARAGREARRSSRPPRQRSLLAVVALIAGSLTGGLAVTVASAPSAAADTAPPPPSGW
NTVFSDNFAGGAGTAPSSANWFYDIGTGYGTGEREQTTNSTNNVYLDGNGHLVLKALNNG
GTWTSGRIESTRDDFQAPPGGELEMSASIQQPNPANGLGYWPAFWSLGAPMRAGGGWPQS
GEIDMMEDVNGLNEASQTLHDSANSPGHPLIACPGAGSGCQTGYHTYSVIIDRTNTSAEQ
MQFLMDGVVESTITEASVGTAAWQAAIDHGFFIIWDLAMGGNYPDGVSGTTTPTAATTSG
ASLSAAWVAVYEKGGNSTPTGTPVSTGAVKDGAGLCLTNQNSLNTEGNPLFATACNGSAG
QSWSPYTDNTVRVQGGCLDVVAAGTTSGTNVDWYACNATNAQNWTRQANGELLNPNSGLC
LTDPGGNAGTRLDLEACTGSPQQTWTFPTGSGGGDTVTVTNPGGQTGTVGTAASVPIHAS
DSASGQTLTYTASGLPAGLSINASTGVISGTPSAAGTSNVTVTATDTTGAAGSTSFSWTI
NPTGGGGTCGTTNLALNQPATASSAENAGTPAADAVDGNAGTRWSSAFSDPQWLQVDLGS
STSICKVVLQWETAYGKAYQIQTSNDGTNWTTIYSTTTGTGGTETLNLSGTGRYIRMNGT
ARNTAYGYSLWEFQVYGSSSGGGGTCGTTNLALNKPATASSAENAGTAAAAAFDGNAGTR
WSSLFTDPQWVQVDLGATHTLCKVGLSWETAYATAFQIQTSNDGTNWTPIYSTTTGTGGT
QSLTVSGSGRYVRMNGTARATQYGYSLWEFQVFGS
Download sequence
Identical sequences C7QGD2
WP_015792706.1.73754 479433.Caci_4113 gi|256393254|ref|YP_003114818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]