SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7Z5C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7Z5C6
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.49e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00046
Further Details:      
 
Domain Number 2 Region: 364-474
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7Z5C6
Sequence length 566
Comment (tr|C7Z5C6|C7Z5C6_NECH7) Predicted protein {ECO:0000313|EMBL:EEU40498.1} KW=Complete proteome; Reference proteome OX=660122 OS=MPVI) (Fusarium solani subsp. pisi). GN=NECHADRAFT_58541 OC=Fusarium; Fusarium solani species complex.
Sequence
MARNRKLRLLVAATGPRDTSWAQALVVRLSKNPQIEARAIVDDVVPRLTQTIIVMQNRSL
ALGMGDRADDVEFYRQQAFELVEWADLMVCVPLDADSIAKMLAGVTDTFLGEVLRGWDTQ
KNIVLVPGMSTHMWSNPMTKKHLNKIHRKWNWIRVVAPILWHYEGTPNPKRVPNWNGFNE
VLGIIKNQADLLGLGRDVEIATGMAMVADVDVKVQSKLPPEIWTIILDYAGDWELAKALG
MYTNLPMPPTWTSRPKDPADPLKVYEHELEWTVLTCNSAAICKKISQSPPEFHDISALVI
KLVIKFGLIDVLAYMEANRPDLFKAFDGTTLPTKASAYYARTDVLDYWKQSRWFRERHIY
DAEAVDGASKNGHVRVLDWWWRRSGLSMRYTESALEQASGSGHLLVLEWWRDAAAQDDKV
VLRPGRSLLWATQYGQADVLRWWDASGIPAAHGDSVAKMASRWGQVDVLETWRRLKGDDK
LVYDAEVLVSPTIYQHLAVLEWWRKFAHGELQGMEGRKQQVEFRTCNIEEALEDSFGDQS
PVRRWWTQNGLNLGLRDEEWLKTRYL
Download sequence
Identical sequences C7Z5C6
jgi|Necha2|58541|estExt_Genewise1.C_sca_18_chr2_1_02080 XP_003046211.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]