SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7ZLV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7ZLV3
Domain Number 1 Region: 8-174,207-325
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.02e-72
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 256-494
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00000000000942
Family Prolyl oligopeptidase, N-terminal domain 0.059
Further Details:      
 
Weak hits

Sequence:  C7ZLV3
Domain Number - Region: 611-708
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000981
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7ZLV3
Sequence length 1220
Comment (tr|C7ZLV3|C7ZLV3_NECH7) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} KW=Complete proteome; Reference proteome OX=660122 OS=MPVI) (Fusarium solani subsp. pisi). GN=NECHADRAFT_59656 OC=Fusarium; Fusarium solani species complex.
Sequence
MQSSPGMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPV
RGVDFHKTQPLFVSGGDDYKIKVWSYQTRRCLFTLNGHLDYVRTVFFHHELPWILSASDD
QTIRIWNWQNRSLICTMTGHNHYAMCAQFHPKEDLVVSASLDQSVRVWDISGLRKKHSAP
TSMSFEDQMARANQNQTDMFGNTDAVVKFVLEGHDRGVNWVAFHPTMPLIVSAGDDRLVK
LWRMSETKAWEVDTCRGHFQNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVQSFKRE
NDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASAVHQNQLFYVTKEKHVKSYDFQKN
IESPTLLSLKKLGSAWVAPRTLSYNPAERSILVTSPAEGGSYELVNLPKDGSGAIEPAES
KRGAGNSAIFVARNRFAVLNSANQTIDIKDLSNNTTRSFKPPVGTTDIYFGGTGNLLIIT
PTAVHLYDIQQKKSTGELAVNGVKYVVWSNDGLYAALLSKHNVTIVTKTLEQVSTLHETI
RIKSATWDDAGVLLYSTLNHVKYTLLNGDNGIVRTLDQTVYLVKVKGRNVYCLDRAAKPR
ILQIDPTEYRFKLALVKRNYEEMLHIIRNSSLVGQSIISYLQKKGYPEIALQFVQDPTTR
FDLAIECGNLDVAVEMAKELDKPKFWTRLSTEALAHGNHQVVEMCYQKLKQFDKLSFLYL
ATGDHSKLARMAKIAEHRGDFTSRFQNAVYLGEVEDRIQMFKEIDLYPLAYMTAKSRGLE
EECQAILEATGLTEEDLTMPTLGAPLSTPKPVVSTFKANWPTKATSQSFFEKALLGQVEG
LSLEDEPAAATGGFEDALEDDSAAKRNVSLIDDDDEDVAGWDMGDDDVPEVDSDFVNVES
ADAGGAASSEADLWARNSPLAVDHIAGGSFETAMQLLNRQVGAVDFAPLKPRFLEVYSAS
RTFLPASQGLSPLVNYVRRTLDETDPRRVLPIIPRDLEHLASNDLQAGYDSMKSNRLDAG
VNIFRGILHSILVNAVSSEDEVAEAKKLIASASEYAVAMDIELSRRQLGSAEVVANDPEK
LQRSLELSAYFTIPKIEVPHRQLALLSAMQLAMRNRNYNSALSFANRIIANGGASKIVEN
ARRAKAQCERNPHDAVEIEFDQFAEFDVCAASHTPIYSGTAFEECAFDGSKYHTQYKGTV
CRVCQVCEIGKHGSGLKLFA
Download sequence
Identical sequences C7ZLV3
XP_003040742.1.20327 jgi|Necha2|59656|estExt_Genewise1.C_sca_59_chr4_1_00025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]