SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9CZT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9CZT3
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily DinB/YfiT-like putative metalloenzymes 4.88e-21
Family YfiT-like putative metal-dependent hydrolases 0.067
Further Details:      
 
Weak hits

Sequence:  C9CZT3
Domain Number - Region: 160-258
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0196
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9CZT3
Sequence length 266
Comment (tr|C9CZT3|C9CZT3_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:EEW58549.1} KW=Complete proteome OX=644076 OS=Silicibacter sp. TrichCH4B. GN=SCH4B_2585 OC=Rhodobacteraceae; Ruegeria.
Sequence
MQQASDFQEESRILARCLEAAPDTIFAATTQFKDWTVEDILGHLHFFNAAAEAALAGPKA
FDRMMAPAMAELAAGRSILALQFPWLAGLSERELFVAWRDGATRLADAYSTADPKKRVKW
VGPEMSALSAITARQMETWAHGQAIFDLLGQERPESDRIRNIVHLGVVTYGWSFRVWGQT
VPEPAPYVELIAPSGEVWTWNTPQDSNHVTGTAVEFAQIVTQTRNWKDTSVAASSEVAQR
WMQQAQCFAGPPNKPPEPGTRFRRPV
Download sequence
Identical sequences C9CZT3
WP_009178004.1.38011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]