SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9Y458 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9Y458
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.56e-23
Family PA0094-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9Y458
Sequence length 143
Comment (tr|C9Y458|C9Y458_CROTZ) Uncharacterized protein {ECO:0000313|EMBL:CBA26812.1} KW=Complete proteome OX=693216 OS=Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032). GN=Ctu_01110 OC=Enterobacteriaceae; Cronobacter.
Sequence
MSQVKYTLSEGTLTLPEAVQDRSMTILSLPKAGASLVLTRAWDVKPGEEETYLKSQVAKI
KRDMKKFTGGDVTDTRMGSRPAQEVTMRFENHGVTVYEQLATTMLEDHLLVMAMSRTAPF
DEDALAIWESIKAGLEFTPGEGA
Download sequence
Identical sequences C9Y458
413502.Ctu_01110 gi|260595903|ref|YP_003208474.1| WP_012814792.1.21474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]