SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0HFM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0HFM0
Domain Number - Region: 150-177,250-309
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0432
Family Pseudo ankyrin repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0HFM0
Sequence length 312
Comment (tr|D0HFM0|D0HFM0_VIBMI) Uncharacterized protein {ECO:0000313|EMBL:EEY43709.1} KW=Complete proteome OX=675820 OS=Vibrio mimicus VM223. GN=VMA_001771 OC=Vibrionaceae; Vibrio.
Sequence
MYIRRGGSVHSAWKLSWVILLAVTGPVGCASNESMSLISEYAKQTSQVQEELLKVYQTAD
EVRINANLVEAARDGVTGKDLQFKTIDNAGQETLLQNLHDFSQSIYLLSTDDRGEALDNN
SEKLNDSLMSLAENSQVNGIDSKQVEIISVSVNALARAYTERARYQYLKQILIDSQPVIQ
SSFDSLNGELEAWKTATKVSLEKELRIRLFLLNNPNLCESRDDAKCVNYYHSLEERVDAY
RKAYALKSHIILLDTQFSKLEKALKAIQNLNISVVNSLNEDDDFSKSAVKKAIKSTQKQI
DAIKEFRNKLKD
Download sequence
Identical sequences D0HFM0
WP_000275926.1.33980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]