SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0N0D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0N0D2
Domain Number - Region: 128-176
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00068
Family Pseudo ankyrin repeat 0.02
Further Details:      
 
Domain Number - Region: 20-95
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0165
Family L-aspartase/fumarase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0N0D2
Sequence length 188
Comment (tr|D0N0D2|D0N0D2_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY67095.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_04026 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAYPVAERLFVSHLRVQGVNPAFLSAATYGKTNVVELLLTTGLITAESLDNAFEAAARLV
GVVHFDTVIFVYMTRRAFLDATNKAHERISDKAIITAFEKATEGEESNINYHSRYQELCI
PTEMICKAFVIAASNGNLEVEEHLYDYHRISAEAMGESFAGAACSNHVDMMTSLYDGQHI
LHGRFSSI
Download sequence
Identical sequences D0N0D2
XP_002905743.1.21288 PITG_04026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]