SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0N6K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0N6K3
Domain Number - Region: 59-128
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000157
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0N6K3
Sequence length 173
Comment (tr|D0N6K3|D0N6K3_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY53202.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_06836 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLDMEARLLAQNAHRGCLGEHGVESLSHVVNRLDEYLYTFSYHWNVARACDAGLSRRGLE
YLAARDPNWGDGRDAAYVAVKNNYPHVLQWLSERYPDRTSWGSLQARCFISTAAKRGHFA
ILKWLHTNRKEGCTFSDQPAAKFGQPSMPITIQPDMTLARPALSTLLSLARPI
Download sequence
Identical sequences D0N6K3
XP_002904820.1.21288 PITG_06836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]