SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0NE93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NE93
Domain Number 1 Region: 172-237
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.71e-19
Family DNA-binding domain from rap30 0.004
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000188
Family Rap30/74 interaction domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0NE93
Sequence length 243
Comment (tr|D0NE93|D0NE93_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY56538.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_10081 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEPEEQVEPLHLELEDREVYLAKIPTALGASWKNVQGSIKLEKKSVLGRRKGMLTVNPS
TLEDDIPTEYRVEISETPLKLKVFSLDGSGRMAIEGTVKNSCTIMAQRNDQYSKMCKQRL
IKSMVKTRIVQPLEDLPRVKKARIQFTIEKPDPEAEEDDADAKLLDKSDKKIKMSKDELK
NLVFHHFEEREYWPLKELNYHCRQPESLLKEVLKEICVYHRKGPNKSCYELKPQYKDGVS
SNA
Download sequence
Identical sequences D0NE93
XP_002902612.1.21288 PITG_10081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]