SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0NGH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NGH2
Domain Number 1 Region: 76-404
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.77e-37
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 19-100
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000275
Family Pseudo ankyrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  D0NGH2
Domain Number - Region: 387-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0149
Family Ankyrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0NGH2
Sequence length 498
Comment (tr|D0NGH2|D0NGH2_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY57373.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_11224 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGAWIRSEESCKVLYSSVTIALAAGEGHLEVVKWLVEARGGECSAAPLHQAARCGQLEVV
EWLYDHSGCIILPRAMDEAAACGYLDVVRFLHERGGRDGGNSKCTTMAMTGAAVNGHLDV
VKWLHENRDEGCTTDALDGAARNGHLELVQWLHEHRSEGCSTQAMNGAARGGHLRIVKFL
HEHRSEGCTYNAMNWAAFENHLAVVQFLHENRTEGCSRHAINEAAKRGHLAMVQWLHSNR
SEGCNRMAMDDAATLSHLDVVSFLHFHRLEGCTVAAMDGAAEHNRLDIVQWLHENRDEGC
SMRAMDRAARNGHLRMVQWLHEHRAEGCTTDAMGGAAEGGHVEVVKFLHANRAEGCTTHA
MDAAARNGHLATVRWLHENRTEGCTATALDGAAANGHLDVVQFLHNNRTDKCTARAMDTA
AGRGDIVMLKWLRKNPHAECSAHASLFAVAHDHVEVLHWLRQHYSSSLARSEDLYSTAQY
YGRVHVQAYLLDLWTPGS
Download sequence
Identical sequences D0NGH2
XP_002901983.1.21288 PITG_11224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]