SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0NR69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NR69
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000327
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0NR69
Sequence length 186
Comment (tr|D0NR69|D0NR69_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY63191.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_15411 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MDGAAAKGRLKIVQWLHHNRKEGGSTAAMDVAAKNGNLQVVKWLHENRTEGCTTKAMDNA
KTFEIMRWLHDNRTEGCTSAAMNRAASDGDFDRVLFLYSQYTEGCTEDAFDNTRKMGLYA
FMRESSFERPSDNINDWLNVVACIPPSLAVYKWSTDTKQNFATPCLRHLHSHRKLAGLSE
KYRKHQ
Download sequence
Identical sequences D0NR69
XP_002898368.1.21288 PITG_15411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]