SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0QZJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0QZJ5
Domain Number 1 Region: 117-421
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.57e-53
Family MoCo biosynthesis proteins 0.0042
Further Details:      
 
Weak hits

Sequence:  D0QZJ5
Domain Number - Region: 39-132
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000379
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0QZJ5
Sequence length 459
Comment (tr|D0QZJ5|D0QZJ5_BACTU) ThnB {ECO:0000313|EMBL:ACY56718.1} OX=1428 OS=Bacillus thuringiensis. GN=thnB OC=Bacillus cereus group.
Sequence
MNGYLFWKEKLEIRKFTSNYESMLVVHKNPNESAPTLKNENTFTINKTATEIIELIDGTK
TYGQVVSFLSLKYSEDPISIEKKLNAFLNNVSKVYNMNIGTQEEPINVPVNLIEEQTIYP
KVASIEITNRCNVRCRHCYGDFGAVKPKVMSLDQIKSLLDDLNNIGVKLIELTGGDITVH
PNLKEILLYALNLDFSQITLLTNGIALSDKVMDIIIKNKSKTFVQIDMHSLDDNYLTWFF
KVPNTLHKIKNNIMKLAENDVRLRIATIVTHLNVHEVEDIAEWVHNLGIDSIGVSPVIPM
GRALGCSDLYLNEEDVKTYGEALLKINKKYPKFVSLYEGARAEIRNCGAITSHIVIAPDG
EIKMCTMHSLDDLKNSIGNVFEQNIKDIYDEKFKYINAFFNLQAPQMDSEECKECENKRF
CSTCFLRSFIKAQEIGDKCKWFKNHVPEIIKEPLMVGQN
Download sequence
Identical sequences B5UXQ7 D0QZJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]