SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0R2C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0R2C9
Domain Number - Region: 12-51
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00458
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0R2C9
Sequence length 114
Comment (tr|D0R2C9|D0R2C9_LACJF) Initiation-control protein YabA {ECO:0000256|HAMAP-Rule:MF_01159, ECO:0000256|SAAS:SAAS00370317} KW=Complete proteome OX=633699 OS=Lactobacillus johnsonii (strain FI9785). GN=FI9785_453 OC=Lactobacillus.
Sequence
MDPFSQLSQLQHNLQAMTKTVAGLENDMLEVLKENTELKVENQLLREKISKLDANKEPAE
NKSQAGLKSLRNIYDSGYHICNMYYGSHRESGEDCMFCLDILDNFVNHGQKSRG
Download sequence
Identical sequences A0A137PN62 C2E2X5 D0R2C9 F4AEU7 F7SCM9 Q74KZ4 V5P1M3
gi|385825352|ref|YP_005861694.1| gi|268318946|ref|YP_003292602.1| 257314.LJ0430 633699.FI9785_453 WP_004895731.1.10084 WP_004895731.1.13362 WP_004895731.1.2199 WP_004895731.1.24787 WP_004895731.1.27409 WP_004895731.1.27769 WP_004895731.1.28348 WP_004895731.1.28407 WP_004895731.1.40168 WP_004895731.1.43572 WP_004895731.1.46682 WP_004895731.1.48560 WP_004895731.1.54950 WP_004895731.1.56141 WP_004895731.1.58924 WP_004895731.1.63737 WP_004895731.1.64510 WP_004895731.1.65350 WP_004895731.1.77592 WP_004895731.1.86701 gi|560151734|ref|YP_008844540.1| gi|42518525|ref|NP_964455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]