SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1JFA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D1JFA4
Domain Number - Region: 57-125
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0785
Family EspA chaperone CesA 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1JFA4
Sequence length 133
Comment (tr|D1JFA4|D1JFA4_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:CBH37212.1} OX=115547 OS=uncultured archaeon. GN=BSM_06890 OC=Archaea; environmental samples.
Sequence
MSPNWEAEQKAPLKNEREKLDEKMAELERNVEALVIEEKQLKADMEREEDAEDDAKFQRL
EERAIARLRNKQAALKKRLNELKKEQRALTQQEKQLKALIEHEKYPEWLELKKKRDNAIK
DVERLELEMKKLI
Download sequence
Identical sequences D1JFA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]