SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1Y6Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D1Y6Y9
Domain Number - Region: 7-29
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0209
Family EB1 dimerisation domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1Y6Y9
Sequence length 45
Comment (tr|D1Y6Y9|D1Y6Y9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EFB89926.1} KW=Complete proteome; Reference proteome OX=352165 OS=Pyramidobacter piscolens W5455. GN=HMPREF7215_1592 OC=Pyramidobacter.
Sequence
MKCAGALLFFERNFYFLYFRKVCIMLKTGRKSIYFVENAPESSIM
Download sequence
Identical sequences D1Y6Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]