SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2H317 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2H317
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2H317
Sequence length 39
Comment (tr|D2H317|D2H317_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB21897.1, ECO:0000313|Ensembl:ENSAMEP00000021199} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_004055 OC=Ailuropoda.
Sequence
QQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLD
Download sequence
Identical sequences D2H317
ENSAMEP00000021199 ENSAMEP00000021199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]