SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HE69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HE69
Domain Number 1 Region: 71-185
Classification Level Classification E-value
Superfamily EndoU-like 4.32e-27
Family Eukaryotic EndoU ribonuclease 0.00078
Further Details:      
 
Domain Number 2 Region: 23-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000183
Family Somatomedin B domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2HE69
Sequence length 186
Comment (tr|D2HE69|D2HE69_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB22329.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_009070 OC=Ailuropoda.
Sequence
EPFLGLEEEVLEAPASNLYTAPSSCRYRCHEAFDRHQPCHCNARCPEFGNCCKDFESLCG
HEGFSYSRDAITKEGLQSISEKIYRADINKAQKEDIILNSQNRILPSETRDQVDRCPEPL
FTYVNEKLFSKPTYAAFISLLNNYQRATGRGEHFDGQQLAEQDAFLREVMKTAVMKELYG
FLRHQS
Download sequence
Identical sequences D2HE69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]