SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2I6H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2I6H8
Domain Number 1 Region: 143-271
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.63e-26
Family GABA-aminotransferase-like 0.00014
Further Details:      
 
Weak hits

Sequence:  D2I6H8
Domain Number - Region: 33-169
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0628
Family P40 nucleoprotein 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2I6H8
Sequence length 275
Comment (tr|D2I6H8|D2I6H8_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB30057.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_021429 OC=Ailuropoda.
Sequence
MVAAAMLLQCCPVLARGHIGLLGKMIKTHQVLFGIGRCPILATQGPNCSQIHLKATKAGG
DSQSWAKSHCPFMLSELQDGKSKIVQKAAPEVQEDVKTFKTDTPRSLASTSLRKPFSNPQ
EPELISEKVTQLVQNNMVGNHVFGYDQFFRHKIMEKKQDHTYRVFKTVNRWADAYPFAQH
FSEASMASKDVSVWCSNDYLGMSRHPRVLQATKETLQRHGVGAGGTRNISGTSKFHVELE
QELAELHQKDAALLFSSCFVANDSTLFTLAKILPG
Download sequence
Identical sequences D2I6H8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]