SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2J073 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2J073
Domain Number - Region: 161-221
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.000275
Family Clostridium neurotoxins, "coiled-coil" domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2J073
Sequence length 335
Comment (tr|D2J073|D2J073_9CAUD) Uncharacterized protein gp51 {ECO:0000313|EMBL:ACZ64200.1} KW=Complete proteome; Reference proteome OX=673839 OS=Enterococcus phage phiFL4A. GN=gp51 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MEWSFPWLSIDGDRMYDDSDFSRFFEGLFSYGVSLTTANALKVTASPNGGMKVQVDSGYS
FTGKVFLNSSAKALSIDVASSTQDRTDSIVVRMDKSVRDVFLAVKKNDTTVTRTSDVYEL
QLATIRVPRNVSSITGDLITDKRADEKVCGYSSPFQKVNVSGLEDQYTALLKAIIDKMNQ
YTEDEKVKFEADMQAILTKGNEYIQQAQADWQTFLESISQSMEGDVALNLQKQITSLTPD
QLLFTKNDLPFDYPMVEVLALINGFGITPLGEENWLGDIPETIPNRIGYPKKNAITVKVP
TDWKMSSPKISEVSPFVYLLNEGNKSVQIKIKESN
Download sequence
Identical sequences D2J073 R3K0E0
D2J073_9CAUD gi|397698868|ref|YP_006536656.1| gi|281416485|ref|YP_003347405.1| WP_010711948.1.101479 WP_010711948.1.102128 WP_010711948.1.11048 WP_010711948.1.15286 WP_010711948.1.25583 WP_010711948.1.31869 WP_010711948.1.40908 WP_010711948.1.57302 WP_010711948.1.63158 WP_010711948.1.95970 YP_003347405.1.54682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]