SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2KZW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2KZW9
Domain Number 1 Region: 174-377
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.4e-109
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000426
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.59e-97
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2KZW9
Sequence length 377
Comment (tr|D2KZW9|D2KZW9_METIV) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:BAI67100.1} OX=2163 OS=Methanobacterium ivanovii. GN=mcrA OC=Methanobacteriaceae; Methanobacterium.
Sequence
FWDDIRRTVIVGLNTAHNVIEKRLGKEVTPETITTYLETVNHAMPGAAVVQEHMVETNPS
LVYDSYVKIFTGNDEIADEIDPAFVININKMFPEEQAEVLKAEVGDAMWQVVRIPTIVSR
TCDGGTTSRWSAMQIGMSMISAYKQAAGEAATGDFAYAAKHAEVVHMGSYLPVRRARGEN
EPGGIAFGFLADICQSSRVNMDDPVRVTLDVVASGAMLYDQIWLGSYMSGGVGFTQYATA
AYTDNILDDFTYFGREYVEDKYGLTEAPNTMETVLDVASEVTFYGLEQYEEYPALLEDQF
GGSQRAAVTAAAAGCSTAFATGNAQTGLSGWYLSMYLHKEQHSRLGFYGYDLQDQCGAAN
TFAIRGDEGLPLEARGA
Download sequence
Identical sequences D2KZW5 D2KZW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]