SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2S3J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2S3J2
Domain Number - Region: 8-58
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0144
Family Lambda phage gpU-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2S3J2
Sequence length 68
Comment (tr|D2S3J2|D2S3J2_HALTV) Uncharacterized protein {ECO:0000313|EMBL:ADB63939.1} KW=Complete proteome; Reference proteome OX=543526 OS=VKM B-1734) (Halococcus turkmenicus). GN=Htur_5052 OC=Haloterrigena.
Sequence
MTDAPIDRFDASAPDTATMTVNGREYEFRADDLPALKAIFDDLEIEGAEVPEAEWSAEGF
RETLEGDK
Download sequence
Identical sequences D2S3J2
gi|284176336|ref|YP_003406612.1| WP_012946178.1.92728 gi|284176336|ref|YP_003406612.1|NC_013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]