SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2V7G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2V7G1
Domain Number 1 Region: 73-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-43
Family G proteins 0.0000921
Further Details:      
 
Weak hits

Sequence:  D2V7G1
Domain Number - Region: 25-65
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0445
Family ETX/MTX2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2V7G1
Sequence length 255
Comment (tr|D2V7G1|D2V7G1_NAEGR) Rab family small GTPase {ECO:0000313|EMBL:EFC47245.1} KW=Complete proteome; Reference proteome OX=5762 OS=Naegleria gruberi (Amoeba). GN=NAEGRDRAFT_64790 OC=Eukaryota; Heterolobosea; Schizopyrenida; Vahlkampfiidae; Naegleria.
Sequence
MGQASTQEKGTKSSMMDADDDEILNNNNSKTTATTHHPTTSSTTSATSSNTVGSKNKINE
SIQIVSIEKENEEEYDYLVKVVLVGDYGVGKTSLAKKISQRGFTTQHQPTIGIDFVVCTL
ILNTKETVRLQLWDTAGQEKFKALASSFFRGADGIFVIADISEKSSFDRVPGFLEDGKKN
CTDDVEFIFIASKTDLRSIGSSTQVLSEEDTKREFRKYDSQIPIIETSAKEDKNVEKALL
TIIQRIYNKKKEAKK
Download sequence
Identical sequences D2V7G1
XP_002679989.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]