SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3I3C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3I3C3
Domain Number - Region: 117-141
Classification Level Classification E-value
Superfamily BRK domain-like 0.0167
Family BRK domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3I3C3
Sequence length 235
Comment (tr|D3I3C3|D3I3C3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EFC73811.1} KW=Complete proteome OX=575612 OS=Prevotella melaninogenica D18. GN=HMPREF0660_00388 OC=Prevotella.
Sequence
MHIDYFWLVNLWLLSFLVAMMLYLKWTAPILDRWNNLLRRSKSFVLLSAAVFFISLGMFF
CKFYVFEQPSNKTEIQDTNSPSSKVPKSRYIFSEKGDPLYILVVLFLTFVYFLIQYKCLK
RWISEHPDYAILVPDLLDKGYVKHKARILNDGFLPISNGLAFRTFNEYLVVPGQHTFHFE
VKESRFKGGDNVLFTQHMDLDLAPSSMYIIKREGKEGKLTYNFKCKRPETNNNIL
Download sequence
Identical sequences D3I3C3
WP_004359121.1.88943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]