SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3J3K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3J3K5
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 3.66e-58
Family Variable surface antigen VlsE 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3J3K5
Sequence length 190
Comment (tr|D3J3K5|D3J3K5_BORBG) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=139 OS=burgdorferi). GN=vlsE OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
EGAIKEVSELLDKLVKAVKTAEGASSGTDAIGEVVADADAAKVADKASVKGIAKGIKEIV
EAAGGSEKLKAVAAAKGENNKGAGKLFGKAGAAAHGDSEAASKAAGAVSAVSGEQILSAI
VKAADAAEQDGKKPEEAKNPIAAAIGDKDGGAEFGQDEMKKDDQIAAAIALRGMAKDGKF
AVKDGERENA
Download sequence
Identical sequences D3J3K5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]