SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4A494 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4A494
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.00000000000000196
Family Cysteine-rich DNA binding domain, (DM domain) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4A494
Sequence length 348
Comment (tr|D4A494|D4A494_RAT) DMRT-like family B with proline-rich C-terminal, 1 {ECO:0000313|Ensembl:ENSRNOP00000054155} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Dmrtb1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MLRTPKCSRCRNHGYLVPVKGHAGKCRWKHCICDKCYLITERQKIMAAQKVLKNQATEEQ
GATVGTQGPQLPPRAPAPAAATATASSSSICPLPRAALGGAGPGPAATCFLERSPQARSP
GPSAFQLVPSGRPGPSTFQPGSGGSGGLHDRPPAWLPQLRPQAPRPELCCPDQHLPVRPV
PRLPFADYGHPLRFKSDHVVGAGYPEREPFKQCPACIPVPPYQPFPLSEGQDSSSALGVP
QQRGFRHVSCGPYHGNSLVSEPARDLQPTYCSPPPPPLPPPPPQPQQPHFLPPGYLSALH
FLPPPPPPPSPPSFSLTILYDTDKEKTNEQGADAPSEPSQQSTQEESN
Download sequence
Identical sequences D4A494
NP_001178690.1.100692 NP_001178690.1.4139 ENSRNOP00000054155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]