SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5DBS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5DBS5
Domain Number 1 Region: 23-210
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 1.15e-44
Family MW0975(SA0943)-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5DBS5
Sequence length 221
Comment (tr|D5DBS5|D5DBS5_BACMD) Putative chromosome partitioning protein {ECO:0000313|EMBL:ADF38186.1} KW=Complete proteome OX=592022 OS=Bacillus megaterium (strain DSM 319). GN=BMD_1325 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKCIGRYIVIGIAAMSLAGCAEGSSPELEVYNGLEKVVAQEKQFADQQKPLADLEQQENA
IYDQIIELGIKDKKKIKNKAQKAQQLLDERESKLQKEEKSISASQKQFEATEPKIQKLED
GKAKEEALELSSLMKKRYKAYQSLHDAYLHSIELDRQLYTLFEKDNVKLENLETQIASIN
ATYKEVEKKKEAFNTLTADYNKAKEDFYNKTKLKVKNSEDK
Download sequence
Identical sequences A0A1Q8URW7 D5DBS5
gi|295703461|ref|YP_003596536.1| WP_013082292.1.11259 WP_013082292.1.18762 WP_013082292.1.71276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]