SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5ECE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ECE6
Domain Number 1 Region: 173-332
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 1.44e-22
Family YbaK/ProRS associated domain 0.0018
Further Details:      
 
Domain Number 2 Region: 403-498
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-18
Family Anticodon-binding domain of Class II aaRS 0.0037
Further Details:      
 
Weak hits

Sequence:  D5ECE6
Domain Number - Region: 38-186
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00497
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5ECE6
Sequence length 509
Comment (tr|D5ECE6|D5ECE6_AMICL) YbaK/prolyl-tRNA synthetase associated region {ECO:0000313|EMBL:ADE56228.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0080 OC=Aminobacterium.
Sequence
MRMTTLLTPTLKKEPAGWQDPGAIRLLRGGYALDLHHGEWSLLPLGALLRDNVAWTFIHA
FMDGGFQQLEDLLYRKEGIQLLAQRVVQSYRDLPLRVMELRGGRLLLSGIEASSSEECQK
NLLYFIENLLENMALSGVKIEDATLGKEGAYIALHAEEEFAASSEGVECPSCGWHGTTHA
HAGETKPFRTEEESSVQEVFTPGAESIDALCSYLEVSSEQTIKTMFYMAEVNGVFQPVTV
LIRGDRQISERKLLVSLGATEVRIAEEKELIEIMGQKPGFLGPVGLPDKLLVIADSSVEG
CKGVVTGANRPEYHLTGVTWGRDFKTERVADIALLEEGMDCPHCGSALRKYLWNGVAAVW
GEPEDALETLYQDQSGSSQKCALWKGWIHLDSIITALARQKTYPLGLAPFDVDIIVPSIK
DETAMELATNLYHEMVHQGVVALFDDRNERAGAKFADFELFGIPAKVVVGRKAAEGIVEV
QYGEEVKEMQACHVTCFLSSLLNDDDTQL
Download sequence
Identical sequences D5ECE6
gi|294101094|ref|YP_003552952.1| WP_013047494.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]