SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5MHU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D5MHU4
Domain Number - Region: 75-116
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0209
Family N-terminal coiled coil domain from apc 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5MHU4
Sequence length 147
Comment (tr|D5MHU4|D5MHU4_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CBE69235.1} KW=Complete proteome; Reference proteome OX=671143 OS=Candidatus Methylomirabilis oxyfera. GN=DAMO_2185 OC=Bacteria; candidate division NC10; Candidatus Methylomirabilis.
Sequence
MHLIKEILHALWTLGSIVGAGLREVVTIMAFTEGGLMRQFRLSRRIIAFSCIVLTGLTVG
SSVTLLNLVRGRYYLTRVKYLEQENRAMTSLLQEQAEQLSTLKIEMAKLKEFEESLRQVA
GLSVASELQTSAPEPAGGRAPSRGRRP
Download sequence
Identical sequences D5MHU4
gi|392375233|ref|YP_003207066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]