SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6KJR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6KJR3
Domain Number 1 Region: 58-186
Classification Level Classification E-value
Superfamily BH3703-like 0.000000549
Family BH3703-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6KJR3
Sequence length 190
Comment (tr|D6KJR3|D6KJR3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFG23122.2} KW=Complete proteome OX=457416 OS=Veillonella sp. 3_1_44. GN=HMPREF0873_01019 OC=Veillonella.
Sequence
MKKIALTALAVMAVVGMFAVQPADAKKVEQDPVVAPIDMPMNDEIQQVNGVSKSTNKETR
RLSNNLAEATKVMIKKNWKTIYIKAVPTGDKDAVRFYYKDNRGQVYNGQVIRNTGLSKGK
YMAGSLHQTEALQELVNHLQQNDQEVPSSIDIIITQEGYRIKTIFNYNEDTSNLPAYLQQ
YEQQNFPSMK
Download sequence
Identical sequences D6KJR3
WP_008714829.1.43318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]