SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6NIW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6NIW0
Domain Number 1 Region: 36-240
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.85e-100
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0000000000126
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6NIW0
Sequence length 240
Comment (tr|D6NIW0|D6NIW0_9ARCH) Methyl coenzyme M reductase subunit A {ECO:0000313|EMBL:ADG63248.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
MIGAYRLCAGESATSEFAFAAKHASVIQMGGMMPARRARGANEPGGIPFGITADCTRSVA
LFPDDPSRAALESIAVGALLYDQLYLGSYMSGGVGFTQYSSATYTDNILEDFVYSGMGIV
KDMYGRLCKAEPSVENIEKITKEVALYCLEQYEKYPTVMESHFGGSQRACCVSAACGTSV
AMATGSATCGVNSWNLAHLIHQEKVGRLGFYGYDLQDMCGASNSFSYRSDEGLPFEMRGP
Download sequence
Identical sequences D6NIW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]