SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6PBF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6PBF8
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 4.84e-16
Family AF0587 domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 2-31,103-172
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.00000000497
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.047
Further Details:      
 
Weak hits

Sequence:  D6PBF8
Domain Number - Region: 188-232
Classification Level Classification E-value
Superfamily PUA domain-like 0.0226
Family PUA domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6PBF8
Sequence length 245
Comment (tr|D6PBF8|D6PBF8_9ARCH) Chain A crystal structure Af0587 protein {ECO:0000313|EMBL:ADD93059.1} OX=743088 OS=uncultured archaeon MedDCM-OCT-S05-C10. GN= OC=Archaea; environmental samples.
Sequence
MVTSPLGLVPRALEDLWPAAHYDIPVTGDWDLDELDMIHSMLARLVERVGYEKVIDHSGM
NLASYFPDLDIIDSREGRTAGNQESLERMESIINELVSELGIRAPKGHRHRIESYRALSR
FQYGVDTWLEDVRIEGRPPKWRLQKNNIQIAQWHPDAGRFAFSKAALPILHETKTLPEIE
LRADIDWRGDIFSTILSSYPTGIRVGDDLLVMQNGKLIGSARATAPHWEWAGSPGRLARS
HHRLG
Download sequence
Identical sequences D6PBF8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]