SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6RQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6RQS9
Domain Number - Region: 28-56
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.0144
Family Nucleolar RNA-binding protein Nop10-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6RQS9
Sequence length 78
Comment (tr|D6RQS9|D6RQS9_COPC7) Uncharacterized protein {ECO:0000313|EMBL:EFI26643.1} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_15415 OC=Coprinopsis.
Sequence
MQRPAAYDEGDDVVVTKDVVTPMGKVSAGAQGSILEPGDWSEKDKCYKYRLKIKSSRAAI
GGHFPGVPEDAIELLFEE
Download sequence
Identical sequences D6RQS9
XP_002910137.1.59657 CC1G_15415T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]