SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6XGB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6XGB1
Domain Number 1 Region: 27-162
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 3.79e-36
Family Ecotin, trypsin inhibitor 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6XGB1
Sequence length 165
Comment (tr|D6XGB1|D6XGB1_TRYB2) Ecotin, putative {ECO:0000313|EMBL:AAZ11288.1} KW=Complete proteome; Reference proteome OX=185431 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1). GN=Tb927.5.1730 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MFGSRKASRRRSYRSRSTMGSRVDIDFCKFEEPPSPREGERRCLFVLDPLEHYVESKDRM
VELLPGRVETVDGVNTYYINGCTTEEKFPGLDYTCYRVDLRDTYRSRCAVPPEATPEEKF
ISHRHRKLIPYNSRKPVVVYLPEDAQLHYRIWTGGQEVVAKKAEE
Download sequence
Identical sequences A0A1G4IHV5 C9ZNX6 D6XGB1 Q57ZP2
Tbg972.5.2420 gi|72389104|ref|XP_844847.1| Tb927.5.1730 XP_011773391.1.14543 XP_844847.1.54365 5691.Tb927.5.1730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]