SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6ZAH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6ZAH0
Domain Number - Region: 16-63
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0484
Family MW0975(SA0943)-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6ZAH0
Sequence length 142
Comment (tr|D6ZAH0|D6ZAH0_SEGRD) Uncharacterized protein {ECO:0000313|EMBL:ADG96712.1} KW=Complete proteome; Reference proteome OX=640132 OS=DSM 44985 / JCM 13578). GN=Srot_0225 OC=Segniliparus.
Sequence
MQPADVLYNMAQSALKRNEQTFQAFQKSMAQRKAQQEALYAQVKEKNTAEPTAEELKAEK
GERKAASIWNDTGKFGNLESEESVSEEPVKRDVRADADTRSFRPVDEDEEAEDAPVGRHS
RPDDGIWGASTRKIGSYQDEEE
Download sequence
Identical sequences D6ZAH0
gi|296392659|ref|YP_003657543.1| WP_013137168.1.68606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]