SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BWB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7BWB2
Domain Number - Region: 255-384
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00445
Family Ricin B-like 0.047
Further Details:      
 
Domain Number - Region: 96-140
Classification Level Classification E-value
Superfamily PKD domain 0.0159
Family PKD domain 0.016
Further Details:      
 
Domain Number - Region: 50-120
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0301
Family ETX/MTX2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7BWB2
Sequence length 398
Comment (tr|D7BWB2|D7BWB2_STRBB) Secreted protein {ECO:0000313|EMBL:ADI11822.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_08704 OC=Streptomyces.
Sequence
MVGPAAAQGATPAADASAVQAGQSCTAADLGKRHPFIKSTEVAPTITHFKGWYVTAGSTG
YQNVTTSTQTTISVSVGLNGEIKGDFAVEALGTVGAMLGLNVQVNYSSTSSESTSVSWNF
NDPGYYGVYKGTKKVTGTYGSLNCNRVQQGDGSWALKWIEGPDSGSYTTYTTLEEGAVRC
EDKVPANSIMRKAQGLLDCETPPRAGHAPGPVASAKATAARNAAAKDTAKGTAGKAATAR
TSAPATRAALNCQPDVYRIHVPGKPLNWSAPVLANDGIRLRESNWTSAHLDNWRLCNVTE
RNGVIEASLWNWGNGGCATIPANIANQEQAYLTTAPCGEDDLQRFYIYRDVPGGSKIGLQ
NKYTGSMLGHDRYADGELIRQYSSGRQDGTGTYDLVKV
Download sequence
Identical sequences D7BWB2
WP_014181271.1.69245 WP_014181271.1.9551 gi|374991458|ref|YP_004966953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]