SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7FED9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7FED9
Domain Number - Region: 28-77
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.053
Family Fibrinogen coiled-coil and central regions 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7FED9
Sequence length 88
Comment (tr|D7FED9|D7FED9_HELP3) Uncharacterized protein {ECO:0000313|EMBL:CBI66546.1} KW=Complete proteome OX=693745 OS=Helicobacter pylori (strain B8). GN=HPB8_989 OC=Helicobacteraceae; Helicobacter.
Sequence
MKKIVVSWCVALAFLRADPAQANKAISNADLIKEIRDLKKIINAQNTEINQLRKVQEVLS
GQLGDMRKDILSTRDYCISLRPYIYNWR
Download sequence
Identical sequences D7FED9
gi|298736484|ref|YP_003729010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]