SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7GXI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7GXI8
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.6e-38
Family Nip7p homolog, N-terminal domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 96-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.29e-24
Family PUA domain 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7GXI8
Sequence length 180
Comment (tr|D7GXI8|D7GXI8_TRICA) 60S ribosome subunit biogenesis protein NIP7 homolog {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC006900 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MKRLSEERTKTLFEKLAKYIGPNVKLLIERPDGIYCFREQKDRVYYISEKILKLAETLPP
NQLISAGTCFGKFTKSNKFRLHITALSYLAPYAQCKVWLKPSAEQQFLYGNHVSKAGLGR
ISENTEKYQGVLVYSMSDLPLGFGVAARSTAECKHADPLAPVCFHQADIGEYIRSEEDLL
Download sequence
Identical sequences D7GXI8
TC006900 7070.XP_971558 XP_971558.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]