SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7J5U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7J5U5
Domain Number - Region: 9-25
Classification Level Classification E-value
Superfamily THUMP domain-like 0.0523
Family PAE0736-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7J5U5
Sequence length 58
Comment (tr|D7J5U5|D7J5U5_9BACE) Uncharacterized protein {ECO:0000313|EMBL:EFI12919.1} KW=Complete proteome OX=585544 OS=Bacteroides sp. D22. GN=HMPREF0106_02830 OC=Bacteroides.
Sequence
MQSFYRWAVVPEWCRCLFFYDAAVFLYSSIERNDTRNFREKKIFRVALSGTLEVKRVN
Download sequence
Identical sequences D7J5U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]