SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7KD22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7KD22
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 7.45e-22
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0001
Further Details:      
 
Weak hits

Sequence:  D7KD22
Domain Number - Region: 135-207
Classification Level Classification E-value
Superfamily Translational machinery components 0.000615
Family ERF1/Dom34 middle domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7KD22
Sequence length 212
Comment (tr|D7KD22|D7KD22_ARALL) Uncharacterized protein {ECO:0000313|EMBL:EFH70375.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_336970 OC=Arabidopsis.
Sequence
MWLLKNELKTLDVAHVGNNKSMFSLIMPYSDPISRVINKLNTEYGSARDIQNNEDRSRYF
WAINSAKKMLKELDTVHYAGLAVYTRTVLNEEGHEVTYTRKFEPNFEPFGPMTASLYQFD
SRFHIAALQRLLDEDDCYGVIVMDRKCIMFATIRDNRHEFHDTYTFLIELMWSHQVRVDM
AYLSYYDKVEELATKYFTSNSHPNMKGCSRQR
Download sequence
Identical sequences D7KD22
59689.fgenesh1_pg.C_scaffold_1003535 jgi|Araly1|336970|fgenesh1_pg.C_scaffold_1003535 XP_002894116.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]